"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D9IXG7"	"{'domain_architectures': 46410, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 46410}"	"['Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII as well as several subsequent electron acceptors', 'This is one of the two reaction center proteins of photosystem II']"	"psbA"	"[{'identifier': 'GO:0009772', 'name': 'photosynthetic electron transport in photosystem II', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0019684', 'name': 'photosynthesis, light reaction', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"D9IXG7_9ALVE"	"73c30af4df54cc5ea0296573b55812fd28876e62"	True	False	False	343	"Photosystem II protein D1"	3	""	"MKTKRFTWMREISRTVFNFVQNTDRRLYIGWFGLLMVPTLLLAVSCFIAAFVAAPPVDIDGIREPVSGSLLYGNNIISGAVVPSSNAIGMHLYTVWDAMCIEEWLYNGGPYQFVVLHFLIGVASYLGREWELSYRLGMRPWIFVAFSAPVAAASAVFLVYPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSLFSAMHGSLVTSTLISMTSEDESPNYGYKFGQEYETYNIVAAHGYFGRLIFQFASFNNSRSLHFFLAIWPVVGIWLTAMGISTMAFNLNGFNFNQSIIDAEGRVISSWADILNRANLGMEVMHERNAHNFPLDLA"	"unreviewed"	"{'taxId': '505693', 'scientificName': 'Chromera velia', 'fullName': 'Chromera velia'}"
