"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D8J2G6"	"{'domain_architectures': 9312, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 9312}"	"[""Catalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor, and NADPH and FADH(2) as the reductant""]"	"thyX"	"[{'identifier': 'GO:0050660', 'name': 'flavin adenine dinucleotide binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0050797', 'name': 'thymidylate synthase (FAD) activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006231', 'name': 'dTMP biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"D8J2G6_HALJB"	"04840fd37d530bca727bb00ea092349a854c8917"	True	False	False	247	"Flavin-dependent thymidylate synthase"	3	"UP000011645"	"MDVRLLEATDDPERVVCLGARNDYMSDFVGDQSFEEVMESVDGGSLEEKKRTLIGHLLSHGHFGPFEHPQITIAVEGISRSCMAQLTRHRHVSFDVQSMRYVAFDEVDPAEVRNGEMVVVPPSASDPNWVGRNQKSGAVDEETVKERERVFTESVSRSVEDYQELLDLGMAPEDARFVLPIGTEVNLVMSMNARMLMHVADMRAAADSQWEIRELTESVLDIAAEWCPLTFEYYDEHMKGRKNRLAP"	"unreviewed"	"{'taxId': '795797', 'scientificName': 'Halalkalicoccus jeotgali (strain DSM 18796 / CECT 7217 / JCM 14584 / KCTC 4019 / B3)', 'fullName': 'Halalkalicoccus jeotgali (strain DSM 18796 / CECT 7217 / JCM 14584 / KCTC 4019 / B3)'}"