General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "D7LDR5",
        "id": "D7LDR5_ARALL",
        "source_organism": {
            "taxId": "81972",
            "scientificName": "Arabidopsis lyrata subsp. lyrata",
            "fullName": "Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress)"
        },
        "name": "Uncharacterized protein",
        "description": [
            "May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins"
        ],
        "length": 406,
        "sequence": "MKTVGGVEQLIPDSISTSFIETVNGSHQFTIKGYSLAKGMSPGKFIQSDVFSVGGYDWAIYFYPDGKNPEDQSLYISLFIALASDSNDIRALFELTLMDQSGKGKHKVHSHFDRALEGGPYTLKYKGSMWGYKRFFKRSALETSDYLKDDCLVINCTVGVVRARLEGPKQYGIVLPLSNMGQGLKDLLDSEVGCDIAFQVGDETYKAHKLILAARSPVFRAQFFGPIGNNNVDRIVIEDIEASIFKAMLSFIYTDVLPDVHEITGSTSASSFTNMIQHLLAAADLYDLARLKILCEVLLCEKLDVDNVATTLALAEQHQFLQLKAFCLKFVASPANLGAVMKSEGFKHLKQSCPTLLSELLNTVAAGDKSSTSGQSNKKRSASSVLGCDTTNVRQVRRRTWDRSKC",
        "proteome": "UP000008694",
        "gene": "ARALYDRAFT_903228",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016567",
                "name": "protein ubiquitination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "26498c42a44f610b103ea2b647c1026c7ab0f79d",
        "counters": {
            "domain_architectures": 7593,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 3,
                "profile": 2,
                "cdd": 3,
                "pfam": 3,
                "smart": 2,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7593
        }
    }
}