"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D7FG74"	"{'domain_architectures': 25665, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 25665}"	"['Involved in transcription antitermination. Required for transcription of ribosomal RNA (rRNA) genes. Binds specifically to the boxA antiterminator sequence of the ribosomal RNA (rrn) operons']"	"nusB"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006353', 'name': 'DNA-templated transcription termination', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"D7FG74_HELP3"	"cc388573da50339aac79362317b07a3762362074"	True	False	False	138	"Transcription antitermination protein NusB"	3	""	"MATRTQARGAVVELLYAFESGNEEIKKIASSMLEEKKIKNNQLAFALSLFNGVLERINEIDALIEPHLKDWDFKRLGSMEKAILRLGAYEIGFTPTQNPIIINECIELGKLYAEPNTPKFLNAILDSLSKKLAQKPLN"	"unreviewed"	"{'taxId': '693745', 'scientificName': 'Helicobacter pylori (strain B8)', 'fullName': 'Helicobacter pylori (strain B8)'}"
