"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D7B3J7"	"{'domain_architectures': 26485, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 26485}"	"['Functions as a ribosomal silencing factor. Interacts with ribosomal protein uL14 (rplN), blocking formation of intersubunit bridge B8. Prevents association of the 30S and 50S ribosomal subunits and the formation of functional ribosomes, thus repressing translation']"	"rsfS"	""	"D7B3J7_NOCDD"	"d48e6f35bd449e7c5e049b7acf80a935592d4454"	True	False	False	132	"Ribosomal silencing factor RsfS"	3	"UP000002219"	"MTATDRALELVRVAAEAASDKLAQEIIAYDVSEQLVITEAFVLCSAPNDRQVRAIVDEVEDQLRLQAGAKPVRREGERDGRWVLLDYADIVVHIQHEEERGYYGLERLWKDCPEIDLPEGARGAQRTPLDEF"	"unreviewed"	"{'taxId': '446468', 'scientificName': 'Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / CIP 107115 / JCM 7437 / KCTC 9190 / NBRC 14626 / NCTC 10488 / NRRL B-5397 / IMRU 509)', 'fullName': 'Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / CIP 107115 / JCM 7437 / KCTC 9190 / NBRC 14626 / NCTC 10488 / NRRL B-5397 / IMRU 509)'}"
