"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D5GN14"	"{'domain_architectures': 5398, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'ncbifam': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5398}"	"['Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell']"	"GSTUM_00011013001"	"[{'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"D5GN14_TUBMM"	"113c073540501dc19ad0c40e1d046cf071b048a2"	True	False	97	"Ribosomal protein L37"	3	"UP000006911"	"MTKGTSSFGKRHNKSHTLCRRCGRRSFHIQKHTCASCGYPAAKVRKYNWSEKAKRRKTTGTGRMRYLKTVSRRFSNRFQLGAPKGARGPQSNADTVE"	"unreviewed"	"{'taxId': '656061', 'scientificName': 'Tuber melanosporum (strain Mel28)', 'fullName': 'Tuber melanosporum (strain Mel28) (Perigord black truffle)'}"