"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D5EUS6"	"{'domain_architectures': 54313, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 54313}"	"['Binds 23S rRNA and is also seen to make contacts with the A and possibly P site tRNAs']"	"rplP"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0019843', 'name': 'rRNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"D5EUS6_XYLR2"	"b8191b67fef66ec97aa545348d03615c51db9614"	True	False	False	142	"Large ribosomal subunit protein uL16"	3	"UP000000927"	"MLQPKRVRYRRPQDGRGNKGNAHRGTTLAFGSFGIKTLDAKWIDSRQIEAARVAINRYMNREGQVWIRIFPDKPITRKPADVRMGKGKGDPAGWVAPVTPGRILFEVEGVPFDIAKEALRLGAQKLPVKTKFVVRRDFDKNA"	"unreviewed"	"{'taxId': '264731', 'scientificName': 'Xylanibacter ruminicola (strain ATCC 19189 / DSM 19721 / CIP 105475 / JCM 8958 / 23)', 'fullName': 'Xylanibacter ruminicola (strain ATCC 19189 / DSM 19721 / CIP 105475 / JCM 8958 / 23)'}"
