"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D4Z0F5"	"{'domain_architectures': 38973, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'hamap': 1, 'ncbifam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 38973}"	"['Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine']"	"msrA"	"[{'identifier': 'GO:0008113', 'name': 'peptide-methionine (S)-S-oxide reductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"D4Z0F5_SPHIU"	"47a64c36b2d13edfc0db84d999e2ce356181eb1f"	True	False	False	185	"Peptide methionine sulfoxide reductase MsrA"	3	"UP000007753"	"MQDKDAHMAEEIATLAGGCFWCTEAVYQNLKGVKAVESGYIGGMLPDPTYEQVCSGATGHAEAIRITYDPAVIGYGDLLDIFFATHDPTTLNRQGNDVGTQYRSAIFPHSPEHAAEARAGIERAQADWANPIVTAIEPDAPWYPAEDYHQKYWERVGDRNPYCMAVIPPKLAKLRKGFAERIEAS"	"unreviewed"	"{'taxId': '452662', 'scientificName': 'Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)', 'fullName': 'Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S)'}"