"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D3VJD9"	"{'domain_architectures': 61377, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 61377}"	"['Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions']"	"hupA"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0030527', 'name': 'structural constituent of chromatin', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"D3VJD9_XENNA"	"69cfcabeafc3186618e3c95978399e9c6cf3360d"	True	False	False	90	"DNA-binding protein HU-alpha (HU-2), plays a role in DNA replication and in rpo translation"	3	"UP000008075"	"MNKTELVDAIAAGADLTKTQAKAALESTLNAITESLKNGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFSAGKALKDAVK"	"unreviewed"	"{'taxId': '406817', 'scientificName': 'Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)', 'fullName': 'Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / CCUG 14189 / LMG 1036 / NCIMB 9965 / AN6)'}"
