"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D3GKW6"	"{'domain_architectures': 55585, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cdd': 1, 'pfam': 1, 'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 55585}"	"['MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation by direct binding to the cis-acting regulatory elements of GL1, thus suppressing the expression of GL1']"	"TCL1"	""	"TCL1_ARATH"	"ba730084eefc9dda4c3f06b10db936f0d80b534d"	True	False	False	84	"MYB-like transcription factor TCL1"	2	"UP000006548"	"MDNTNRLRRLHCHKQPKFTHSSQEVSSMKWEFINMTEQEEDLIFRMYRLVGDRWDLIARRVVGREAKEIERYWIMRNCDYFSHK"	"reviewed"	"{'taxId': '3702', 'scientificName': 'Arabidopsis thaliana', 'fullName': 'Arabidopsis thaliana (Mouse-ear cress)'}"