"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D2RKV9"	"{'domain_architectures': 24988, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'ncbifam': 1, 'hamap': 1, 'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 24988}"	"['Binds directly to 16S ribosomal RNA']"	"rpsT"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005840', 'name': 'ribosome', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"D2RKV9_ACIFV"	"e09535fcfc3103716d6aac033e719e2ca67f3f51"	True	False	False	87	"Small ribosomal subunit protein bS20"	3	"UP000001902"	"MPNIKSSIRSVKTDAERRAANGPVKAEIRSTARKVEAFAAAGSKEEAQATLKVAASLLDKAARKGTVNKKAAARKKSRLAKKVNAVK"	"unreviewed"	"{'taxId': '591001', 'scientificName': 'Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / CCUG 9996 / CIP 106432 / VR4)', 'fullName': 'Acidaminococcus fermentans (strain ATCC 25085 / DSM 20731 / CCUG 9996 / CIP 106432 / VR4)'}"