HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D2RE48",
"id": "D2RE48_ARCPA",
"source_organism": {
"taxId": "572546",
"scientificName": "Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18)",
"fullName": "Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18)"
},
"name": "Large ribosomal subunit protein eL19",
"description": [
"Binds to the 23S rRNA"
],
"length": 147,
"sequence": "MDLRLQRRLAAEVLECGMNRVWFDPTALDEIASAATKDDIRELIERGLIKRKPVKGVCRVRINYRKMQKRKGRRRGHGSRKGKKTARLSRKDAWIMRIRALRKRLRELRDKGVIDRRTYRMLYLKAKGGEFRSVSHLNAYIEQLLSR",
"proteome": "UP000001901",
"gene": "rpl19e",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0022625",
"name": "cytosolic large ribosomal subunit",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "857f7c189db2741db28d17819df48b7cdcddcd0c",
"counters": {
"domain_architectures": 5410,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 2,
"smart": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5410
}
}
}