GET /api/protein/UniProt/D2C433/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "D2C433",
"id": "D2C433_THEP2",
"source_organism": {
"taxId": "590168",
"scientificName": "Thermotoga petrophila (strain ATCC BAA-489 / DSM 13996 / JCM 10882 / RKU-10)",
"fullName": "Thermotoga petrophila (strain ATCC BAA-489 / DSM 13996 / JCM 10882 / RKU-10)"
},
"name": "Isoprenyl transferase",
"description": [
"Catalyzes the condensation of isopentenyl diphosphate (IPP) with allylic pyrophosphates generating different type of terpenoids"
],
"length": 233,
"sequence": "MRIPQHVAIIMDGNGRWAKKRGLPRIKGHQRGAKVLHNTVKWSLEMGIKYLTAFSFSTENWKRPKEEVEFLMDLFVQMIDREMELLRKERVRVRILGRKEGLSEKVLKKWQEVEEKTKEFDRMTLVIAFNYGGRREILDAVESILKDVSQGKKIELTEETFRQYLYLPDVPDPDLIIRTSGEMRLSNFLLWQSAYSELYFFKKPWPDFTKKDFLRAIESYSKRERRFGGLING",
"proteome": "UP000000940",
"gene": "Tnap_1405",
"go_terms": [
{
"identifier": "GO:0016765",
"name": "transferase activity, transferring alkyl or aryl (other than methyl) groups",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f9296ca8c67aab66dba96afb706e180e443bedbe",
"counters": {
"domain_architectures": 40247,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"ncbifam": 3,
"panther": 1,
"hamap": 1,
"pfam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 40247
}
}
}