"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D2C190"	"{'domain_architectures': 26807, 'entries': 26, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 3, 'profile': 2, 'smart': 2, 'cdd': 1, 'cathgene3d': 2, 'ssf': 3, 'ncbifam': 2, 'panther': 1, 'hamap': 1, 'prosite': 1, 'interpro': 8}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 26807}"	"[""Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized purines, such as 7,8-dihydro-8-oxoguanine (8-oxoG). Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates""]"	"mutM"	"[{'identifier': 'GO:0003906', 'name': 'DNA-(apurinic or apyrimidinic site) endonuclease activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019104', 'name': 'DNA N-glycosylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006284', 'name': 'base-excision repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003684', 'name': 'damaged DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016799', 'name': 'hydrolase activity, hydrolyzing N-glycosyl compounds', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008534', 'name': 'oxidized purine nucleobase lesion DNA N-glycosylase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006281', 'name': 'DNA repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"D2C190_DICZ5"	"80cde816fdd044952e2dc733f0e587d4b1b6f0f6"	True	False	False	269	"Formamidopyrimidine-DNA glycosylase"	3	"UP000001446"	"MPELPEVETSRRGISPWLVGRTILYAEVRNARLRWPVSPEILSLSDTPVLSVQRRAKYLLLELPTGWIIIHLGMSGSLRVLPEYSEPDKHDHVDLVMDSGKVLRYTDPRRFGAWLWCDDLANSSVLAHLGPEPLSDDFSGDYLFSRCHGRKTPIKLWIMDNKLVVGVGNIYASESLFNAGILPERPAGSLSQQEAHQLVQSIKQVLQRSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRNGKPCHHCGTLIDSIKQGQRSTFFCKRCQR"	"unreviewed"	"{'taxId': '590409', 'scientificName': 'Dickeya zeae (strain Ech586)', 'fullName': 'Dickeya zeae (strain Ech586)'}"