"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D2BIH5"	"{'domain_architectures': 32111, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'cdd': 1, 'pfam': 1, 'ncbifam': 2, 'hamap': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 32111}"	"['Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical purine nucleotides XTP (xanthosine triphosphate), dITP (deoxyinosine triphosphate) and ITP. Seems to function as a house-cleaning enzyme that removes non-canonical purine nucleotides from the nucleotide pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions']"	"DhcVS_1008"	"[{'identifier': 'GO:0047429', 'name': 'nucleoside triphosphate diphosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009143', 'name': 'nucleoside triphosphate catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0017111', 'name': 'ribonucleoside triphosphate phosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"D2BIH5_DEHMV"	"029a777975285995c6aff1e90978714c8929fb21"	True	False	False	199	"dITP/XTP pyrophosphatase"	3	""	"MPKLLLASNNRGKLREYASLLSGSGFELVTPADMGIDITVAETGTTFEENARLKAAALAEASGLLTLADDSGLTVDALGGEPGVYSARYAGENALDTDRNKYILSKLENIPAEKRTARFRCVIAIAQPGHIIATFEGTCEGVISTEPRGTNGFGYDPVFYLPEYGKTMAELPSEIKNSISHRSIAAQKASLFLAEIATS"	"unreviewed"	"{'taxId': '311424', 'scientificName': 'Dehalococcoides mccartyi (strain VS)', 'fullName': 'Dehalococcoides mccartyi (strain VS)'}"
