"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"D0VWV4"	"{'domain_architectures': 33091, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 23, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'cdd': 1, 'panther': 1, 'pfam': 1, 'ncbifam': 1, 'prosite': 2, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 33091}"	"['Membrane-anchoring subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q) (PubMed:17480203). SDH also oxidizes malate to the non-canonical enol form of oxaloacetate, enol-oxaloacetate (By similarity). Enol-oxaloacetate, which is a potent inhibitor of the succinate dehydrogenase activity, is further isomerized into keto-oxaloacetate (By similarity)']"	"SDHC"	"[{'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006099', 'name': 'tricarboxylic acid cycle', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"C560_PIG"	"2d2fccedb0949fe538838b81bc38ff5443336040"	True	False	False	169	"Succinate dehydrogenase cytochrome b560 subunit, mitochondrial"	1	"UP000008227"	"MAALLLRHVGRHCLRAHLSPQLCIRNAVPLGTTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSSVGLAAM"	"reviewed"	"{'taxId': '9823', 'scientificName': 'Sus scrofa', 'fullName': 'Sus scrofa (Pig)'}"