GET /api/protein/UniProt/C9Y4P4/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 109.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C9Y4P4",
        "id": "C9Y4P4_CROTZ",
        "source_organism": {
            "taxId": "693216",
            "scientificName": "Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)",
            "fullName": "Cronobacter turicensis (strain DSM 18703 / CCUG 55852 / LMG 23827 / z3032)"
        },
        "name": "Met repressor",
        "description": [
            "This regulatory protein, when combined with SAM (S-adenosylmethionine) represses the expression of the methionine regulon and of enzymes involved in SAM synthesis"
        ],
        "length": 105,
        "sequence": "MAEWNGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQVNNLRHATNSELLCEAFLHAFTGQPLPDDDDLRKERSDEIPEEAKVIMREMGIDPDTWEY",
        "proteome": "UP000002069",
        "gene": "metJ",
        "go_terms": [
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006555",
                "name": "L-methionine metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "19d53d712b344eb4960aeee4e25a4c7a80d742db",
        "counters": {
            "domain_architectures": 1372,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1372
        }
    }
}