"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C7SAG7"	"{'domain_architectures': 19477, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'cathgene3d': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 19477}"	"['Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis']"	"cytb"	"[{'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"C7SAG7_LEPEU"	"35fdfd4f934bf55a6d167a2125a6bd674b082c9f"	True	False	True	153	"Cytochrome b"	4	""	"KDAVGFLMLILLLMLLVLFSPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVMSILILAIIPFLHMSKQRSMMFRPISQVLFWILVADLLTLTWIGGEPVEHPFITIGQVASILYFSIILILMPLASLVENKILKW"	"unreviewed"	"{'taxId': '9983', 'scientificName': 'Lepus europaeus', 'fullName': 'Lepus europaeus (European hare)'}"
