"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C7QZS9"	"{'domain_architectures': 32953, 'entries': 21, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'smart': 1, 'pfam': 2, 'cdd': 2, 'cathgene3d': 2, 'hamap': 1, 'panther': 1, 'ncbifam': 2, 'pirsf': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 32953}"	"['Catalyzes the NADPH-dependent formation of L-aspartate-semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl-4-phosphate']"	"asd"	"[{'identifier': 'GO:0016620', 'name': 'oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051287', 'name': 'NAD binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0046983', 'name': 'protein dimerization activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0008652', 'name': 'amino acid biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0004073', 'name': 'aspartate-semialdehyde dehydrogenase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0050661', 'name': 'NADP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009088', 'name': 'L-threonine biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009089', 'name': 'L-lysine biosynthetic process via diaminopimelate', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0009097', 'name': 'isoleucine biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006520', 'name': 'amino acid metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"C7QZS9_JONDD"	"f9fead37a78f3f17b34aebdc17f03c19c953c120"	True	False	False	349	"Aspartate-semialdehyde dehydrogenase"	3	"UP000000628"	"MTVTVAVVGATGQVGQVMRDLLAQRQFSADQVRFIASARSAGTTLPFRGQDITVEDIETADLSGIDIALFSAGGGTSKTHAPRFAEAGAIVVDNSSAWRLDPDVPLIVAEVNPEAVKDARKGIIANPNCTTMAAMPVLKPLHDAAGLERLIVSTYQAVSGSGVAGVRELTGQITAGASQDLSALARDGQAVTLPEPTTYVQPIAFNVVALAGSLVDDGSGETDEEQKLRNESRKILSLPSLAVSGTCVRVPVYSGHSLTINAEFSRPLSPERARELLADAPGVELVDVPSPLTAAGKDPSFVGRLRVDQSVPDGRGLALFVSNDNLRKGAALNAVQIAELLVEHLAQQQ"	"unreviewed"	"{'taxId': '471856', 'scientificName': 'Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / BCRC 15368 / CIP 55.134 / JCM 11481 / NBRC 15587 / NCTC 10816 / Prevot 55134)', 'fullName': 'Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / BCRC 15368 / CIP 55.134 / JCM 11481 / NBRC 15587 / NCTC 10816 / Prevot 55134)'}"
