"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C7LJG6"	"{'domain_architectures': 10048, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'smart': 1, 'panther': 1, 'pirsf': 1, 'ncbifam': 2, 'hamap': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 10048}"	"['Catalyzes the formation of methylglyoxal from dihydroxyacetone phosphate']"	"mgsA"	"[{'identifier': 'GO:0008929', 'name': 'methylglyoxal synthase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019242', 'name': 'methylglyoxal biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"C7LJG6_BRUMC"	"8bbe8519f7a14947be537e7704261d68259ca531"	True	False	False	125	"Methylglyoxal synthase"	3	"UP000002188"	"MTQRLRIALIAHDQKKDDMVAFARAHEQALSRYDIVATGTTGGLIQDACPSLNIHRVKSGPLGGDQQIGAMIAEGTVEVLIFFIDPLSPLPHDVDVKALTRLGSVYDIPMALNRATAEKLVRALD"	"unreviewed"	"{'taxId': '568815', 'scientificName': 'Brucella microti (strain BCCN 7-01 / CAPM 6434 / CCM 4915)', 'fullName': 'Brucella microti (strain BCCN 7-01 / CAPM 6434 / CCM 4915)'}"
