"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C7GN53"	"{'domain_architectures': 3920, 'entries': 3, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3920}"	"['Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors']"	"MED4"	"[{'identifier': 'GO:0003712', 'name': 'transcription coregulator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006357', 'name': 'regulation of transcription by RNA polymerase II', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016592', 'name': 'mediator complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"C7GN53_YEAS2"	"df02bd15180618eed48fd84dfe589d7a1bec2ae9"	True	False	False	284	"Mediator of RNA polymerase II transcription subunit 4"	3	""	"MSVQDTKAVEFSMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECRDELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMASLHSKELTRIPGEEVEETEVPTVPPSQSEEQKGQMAKKEGTPKTDSFIFDGTAKEVGDEADNTKDKEKEENNDDALDLDLDLFDPDDF"	"unreviewed"	"{'taxId': '574961', 'scientificName': 'Saccharomyces cerevisiae (strain JAY291)', 'fullName': ""Saccharomyces cerevisiae (strain JAY291) (Baker's yeast)""}"