"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C7C8N7"	"{'domain_architectures': 4123, 'entries': 19, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 2, 'pfam': 2, 'smart': 1, 'cdd': 1, 'ncbifam': 2, 'hamap': 1, 'pirsf': 1, 'panther': 1, 'prints': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 4123}"	"['Catalyzes the reaction of cyanate with bicarbonate to produce ammonia and carbon dioxide']"	"cynS"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009440', 'name': 'cyanate catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008824', 'name': 'cyanate hydratase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"C7C8N7_METED"	"f8e3eab37ce2e4e7d0eab361a76eb7e715f8b4f5"	True	False	False	162	"Cyanate hydratase"	3	""	"MKREDLTEKLLDIKREKGWTWKYIQDEIGGISPILITAACMGQMKLPKAQAKKAAELFGLSQAEERMLNEAPYRGSIPQMPPTDPLIYRFYELVMVYGTTWKELIQEEFGDGIMSAIDFNMTMEREPNNKGDRVKMNLSGKFLPYKYYGNEDGVPEYGFKEP"	"unreviewed"	"{'taxId': '661410', 'scientificName': 'Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)', 'fullName': 'Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)'}"