"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C6SUS4"	"{'domain_architectures': 5475, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5475}"	"['Functions as a heterodimeric glycoprotein hormone with GPHA2 able to bind and activate the thyroid-stimulating hormone receptor (TSHR), leading to increased cAMP production. Plays a central role in controlling thyroid cell metabolism']"	"gphb5"	"[{'identifier': 'GO:0005179', 'name': 'hormone activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"C6SUS4_DANRE"	"98a435d7a25d82e42884f0ece7da600b2af78af9"	True	False	False	134	"Glycoprotein hormone beta-5"	2	"UP000000437"	"MALLRSGAQGLCCVTLAVLLCCGAYTEASVLNLRRFIGCAVREFTFLARKPGCGGLHITTDACWGRCETWQKPVLEPPFIESHQRVCTYNETRQETVLLPNCTAGVDPSYSFPVALRCDCGLCLTSTTECITSV"	"unreviewed"	"{'taxId': '7955', 'scientificName': 'Danio rerio', 'fullName': 'Danio rerio (Zebrafish)'}"