"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C6H6G8"	"{'domain_architectures': 273930, 'entries': 18, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 3, 'cathgene3d': 1, 'smart': 4, 'ssf': 1, 'ncbifam': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prints': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 273930}"	"['GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle']"	"HCDG_02019"	"[{'identifier': 'GO:0003924', 'name': 'GTPase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006913', 'name': 'nucleocytoplasmic transport', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"C6H6G8_AJECH"	"31aa1b32c82271990f81b4779ae58d1cb9b14b00"	True	False	False	213	"GTP-binding nuclear protein"	3	""	"MAAPPTFKLVLVGDGGTGKTTFVKRHLTGEFEKRYIATLGVEVHPLNFQTNLGPIRFDVWDTAGQEKFGGLRDGYYINGQCGIIMFDVTSRITYKNVPSWHRDLVRVCENVPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLVGNPGLEFVADIALAPPEATVDPAAIAAAEEEMRQAAQMPLPDEDDADF"	"unreviewed"	"{'taxId': '544712', 'scientificName': 'Ajellomyces capsulatus (strain H143)', 'fullName': ""Ajellomyces capsulatus (strain H143) (Darling's disease fungus)""}"
