"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C6CMK2"	"{'domain_architectures': 136430, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'ncbifam': 1, 'panther': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 136430}"	"[""Purine salvage pathway enzyme that catalyzes the transfer of the ribosyl-5-phosphate group from 5-phospho-alpha-D-ribose 1-diphosphate (PRPP) to the N9 position of the 6-oxopurines guanine and xanthine to form the corresponding ribonucleotides GMP (guanosine 5'-monophosphate) and XMP (xanthosine 5'-monophosphate), with the release of PPi. To a lesser extent, also acts on hypoxanthine""]"	"gpt"	"[{'identifier': 'GO:0000310', 'name': 'xanthine phosphoribosyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"C6CMK2_DICC1"	"0f8ac38f062a402c09070bf5cbec330fb03fbefd"	True	False	False	152	"Xanthine-guanine phosphoribosyltransferase"	3	""	"MSEKYIVTWDMLQIHARKLAQRLLPAEQWKGIIAVSRGGLVPGALLAREMGIRNVDTVCISSYDHDNQRELKVLKRAEGDGEGYIVIDDLVDTGGTAKAIREMYPKAHFITIFAKPAGKPLVDDYEVDIPQDTWIEQPWDMGVVFVPPLVGR"	"unreviewed"	"{'taxId': '561229', 'scientificName': 'Dickeya chrysanthemi (strain Ech1591)', 'fullName': 'Dickeya chrysanthemi (strain Ech1591)'}"