"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C5IAS4"	"{'domain_architectures': 2302, 'entries': 5, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2302}"	"['Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta)']"	"E7"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"C5IAS4_9PAPI"	"775889284a0d0bec2201f51c28688b33e858eeb5"	False	False	False	127	"Protein E7"	3	""	"MVQGPNTHRNLDDSPAGPLLILSPCAGTPTRSPAAPDAPDFRHPCHFGRPTRKRGPTTPPLSSPGKLCATGPRRVYSVTVCCENCGKELTFAVKTSSTSLLGFDNLLNSDLDLLCPRCESRERHGKR"	"unreviewed"	"{'taxId': '10571', 'scientificName': 'Bovine papillomavirus', 'fullName': 'Bovine papillomavirus'}"
