GET /api/protein/UniProt/C5FQJ4/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "C5FQJ4",
"id": "MEP6_ARTOC",
"source_organism": {
"taxId": "554155",
"scientificName": "Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)",
"fullName": "Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)"
},
"name": "Extracellular metalloprotease MCYG_04966",
"description": [
"Secreted metalloproteinase that allows assimilation of proteinaceous substrates. Plays a pivotal role as a pathogenicity determinant during infections and contributes to the ability of the pathogen to persist within the mammalian host (By similarity)"
],
"length": 270,
"sequence": "MRLSLFLSGLAAAGSIVSAERTCGAVPPRGYEKEFSEAFAALGPEATSDLTAGITIDTYLHVLTSGTTGNIPDSQLQAQINAMNQHYGPSGVQFRLVKATRTNNANWASGRDEAGMKSALHMGTYSSLNIYFIPNLSSGLLGICYFPRANPSQTTITMDGCMVRSGTVPGGETTNYNQGKTATHEVGHFLGLYHVFSENGSCVDADMVADTPPQSKKTSGCPNSQDSCPGGGVDSIHNYMDYSYDVCMNQFTRGQASRIAQAWQAFRAGH",
"proteome": "UP000002035",
"gene": "MCYG_04966",
"go_terms": [
{
"identifier": "GO:0008237",
"name": "metallopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e1aeecffd13d5a804d6aafd21bb868194020c0f6",
"counters": {
"domain_architectures": 6504,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6504
}
}
}