GET /api/protein/UniProt/C5FQJ4/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C5FQJ4",
        "id": "MEP6_ARTOC",
        "source_organism": {
            "taxId": "554155",
            "scientificName": "Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)",
            "fullName": "Arthroderma otae (strain ATCC MYA-4605 / CBS 113480)"
        },
        "name": "Extracellular metalloprotease MCYG_04966",
        "description": [
            "Secreted metalloproteinase that allows assimilation of proteinaceous substrates. Plays a pivotal role as a pathogenicity determinant during infections and contributes to the ability of the pathogen to persist within the mammalian host (By similarity)"
        ],
        "length": 270,
        "sequence": "MRLSLFLSGLAAAGSIVSAERTCGAVPPRGYEKEFSEAFAALGPEATSDLTAGITIDTYLHVLTSGTTGNIPDSQLQAQINAMNQHYGPSGVQFRLVKATRTNNANWASGRDEAGMKSALHMGTYSSLNIYFIPNLSSGLLGICYFPRANPSQTTITMDGCMVRSGTVPGGETTNYNQGKTATHEVGHFLGLYHVFSENGSCVDADMVADTPPQSKKTSGCPNSQDSCPGGGVDSIHNYMDYSYDVCMNQFTRGQASRIAQAWQAFRAGH",
        "proteome": "UP000002035",
        "gene": "MCYG_04966",
        "go_terms": [
            {
                "identifier": "GO:0008237",
                "name": "metallopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e1aeecffd13d5a804d6aafd21bb868194020c0f6",
        "counters": {
            "domain_architectures": 6504,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6504
        }
    }
}