"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C4XEC9"	"{'domain_architectures': 82434, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'ncbifam': 2, 'pfam': 1, 'panther': 1, 'hamap': 1, 'prints': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 82434}"	"[""Reversibly transfers an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate""]"	"coaD"	"[{'identifier': 'GO:0003824', 'name': 'catalytic activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009058', 'name': 'biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0004595', 'name': 'pantetheine-phosphate adenylyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015937', 'name': 'coenzyme A biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"C4XEC9_MYCFP"	"67074276eca3dd0a1392f72a13e344b6dc27e68b"	True	False	False	144	"Phosphopantetheine adenylyltransferase"	3	"UP000006810"	"MIMIKKAIFPGSFDPIHKGHISVIEKALKLFDELIVIVSINPDKNNLGNLEERYQSVKKTLKDYKTVTVVKNENDLIAQIAKEKNVKFLVRSARNNLDYDYELVLAAANHHLNSELETILIVPDYENIDYSSTLLRHKQKLGKK"	"unreviewed"	"{'taxId': '496833', 'scientificName': 'Mycoplasmopsis fermentans (strain ATCC 19989 / NBRC 14854 / NCTC 10117 / PG18)', 'fullName': 'Mycoplasmopsis fermentans (strain ATCC 19989 / NBRC 14854 / NCTC 10117 / PG18)'}"
