"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C4MCK5"	"{'domain_architectures': 54294, 'entries': 20, 'isoforms': 0, 'proteomes': 0, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'ssf': 2, 'smart': 1, 'cathgene3d': 2, 'cdd': 1, 'panther': 1, 'prints': 2, 'prosite': 1, 'interpro': 8}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 54294}"	"['Tubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a stabilizing cap forms. Below the cap, tubulin dimers are in GDP-bound state, owing to GTPase activity of alpha-tubulin']"	"btub"	"[{'identifier': 'GO:0005525', 'name': 'GTP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007017', 'name': 'microtubule-based process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005874', 'name': 'microtubule', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0003924', 'name': 'GTPase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005200', 'name': 'structural constituent of cytoskeleton', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"C4MCK5_9EURO"	"9b3c3afba4e26bfbe1001f745b27d736c962bd9e"	True	False	True	258	"Tubulin beta chain"	3	""	"YVPRAVLVDLEPAALDAVRAGPFGQLFRPDNVVFGQSGAGNNWAKGHYTEGANLVDQVIDVVRREAEGCDCLQGFQITHSLGGGTGAGMGTLLISKIREEFPDRMMATFSVVPSPMVSDTVVEPYNATLSIHQLVEHSDETFCIDNEALYNICMKTLKLTNPSYGDLNHLVSAVMSGVSTSLRFPGQLNSDLRKLAVNMVPFPRLHFFMVGFAPLTSRNAYSFRAVSVPELTQQMFDPKNMMAATDFRSGRYLTCSAI"	"unreviewed"	"{'taxId': '74035', 'scientificName': 'Arthroderma uncinatum', 'fullName': 'Arthroderma uncinatum'}"