"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C4LKV3"	"{'domain_architectures': 38603, 'entries': 17, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'pfam': 1, 'cdd': 1, 'ncbifam': 4, 'panther': 1, 'hamap': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 38603}"	"['Together with the chaperonin GroEL, plays an essential role in assisting protein folding. The GroEL-GroES system forms a nano-cage that allows encapsulation of the non-native substrate proteins and provides a physical environment optimized to promote and accelerate protein folding. GroES binds to the apical surface of the GroEL ring, thereby capping the opening of the GroEL channel']"	"groES"	"[{'identifier': 'GO:0006457', 'name': 'protein folding', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0044183', 'name': 'protein folding chaperone', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"CH10_CORK4"	"96ac8ba8a540be879c6c062e6821e3878208f354"	True	False	False	99	"Co-chaperonin GroES"	3	"UP000001473"	"MAKVNIKPLEDKLLVQIVEAETTTASGLVIPDTAKEKPQEATVVAVGPGRTDENGKRVPMDVAEGDVVIFSKYGGTEIKYAGEEYLILSQRDVLAVVEK"	"reviewed"	"{'taxId': '645127', 'scientificName': 'Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)', 'fullName': 'Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)'}"