"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C3Z6W5"	"{'domain_architectures': 28831, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'hamap': 2, 'panther': 1, 'pfam': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 28831}"	"['Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Negatively regulates cilium formation and structure']"	"BRAFLDRAFT_275293"	"[{'identifier': 'GO:0005524', 'name': 'ATP binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0140663', 'name': 'ATP-dependent FeS chaperone activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016226', 'name': 'iron-sulfur cluster assembly', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"C3Z6W5_BRAFL"	"3cbfa3de54076f1e90790dfecfba67c11e53357e"	True	False	False	266	"Cytosolic Fe-S cluster assembly factor NUBP2 homolog"	3	""	"MSGVQHVVLILSGKGGVGKSTVAAQLALALRQAGKKVGILDVDLCGPSIPRMFDVEGHDVHQCPGGWVPVYPDQDQRLALMSIGFLLQARDDAVVWRGPKKNAMIKQFIGDVVWGELDYLIIDTPPGTSDEHISVVENVRQYSPDGAVLVTTPQGVAVGDVRRELTFCRKTKLPVLGVIENMSGFVCPHCTECTNVFSKGGGEALANQFNVPFLGCVPLDPQLTRSLEEGQRFVDAFPTSTAAQAIGRVAQTILQRGEQQENMDTS"	"unreviewed"	"{'taxId': '7739', 'scientificName': 'Branchiostoma floridae', 'fullName': 'Branchiostoma floridae (Florida lancelet)'}"
