"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C3K7C1"	"{'domain_architectures': 9660, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'ncbifam': 2, 'panther': 1, 'pfam': 1, 'prints': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 9660}"	"['One of the proteins required for the normal export of preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA']"	"secB"	"[{'identifier': 'GO:0051082', 'name': 'unfolded protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0015031', 'name': 'protein transport', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0051262', 'name': 'protein tetramerization', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"SECB_PSEFS"	"f0a036645021158493403eb20eadf6fd71476d92"	True	False	False	159	"Protein-export protein SecB"	3	""	"MTDQQNTEAAEAQGPQFSLQRIYVRDLSFEAPKSPAIFRQEWTPSVALDLNTRQKALEGDFHEVVLTLSVTVKNGEEVAFIAEVQQAGIFLIQGLDEASMSHTLGAFCPNILFPYARETLDSLVTRGSFPALMLAPVNFDALYAQELQRMQQEGSSTVQ"	"reviewed"	"{'taxId': '216595', 'scientificName': 'Pseudomonas fluorescens (strain SBW25)', 'fullName': 'Pseudomonas fluorescens (strain SBW25)'}"