"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C1FE24"	"{'domain_architectures': 32487, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 32487}"	"['Cytoplasmic and mitochondrial threonylcarbamoyl-AMP synthase required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Catalyzes the conversion of L-threonine, HCO(3)(-)/CO(2) and ATP to give threonylcarbamoyl-AMP (TC-AMP) as the acyladenylate intermediate, with the release of diphosphate. Participates in t(6)A37 formation in cytoplasmic and mitochondrial tRNAs. May regulate the activity of some transporters']"	"MICPUN_51618"	"[{'identifier': 'GO:0003725', 'name': 'double-stranded RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"C1FE24_MICCC"	"fd062f70d155d26836135770b3359d66636068af"	True	False	False	289	"Threonylcarbamoyl-AMP synthase"	3	"UP000002009"	"MYMKQSRYCIYICTFEGTFIRTFVRNKFRDISIHLLIKPEHVLAPVKTKVDLTIILQLSRPWRYFRLLMIIRACQLRILPATSQRVTDAVDALRRERIIAVPTDTLYGLAAGAHSDKSIRRLYAAKRRSETVPIAICVSDAKDVERYADTKHLAEGLLDELLPGPVTVLLSQKSSADLPSSLNPNSRLMGIRIPKSDFIRAVARQYGHALALTSANQSGSASTLDLNEFTELWDDCAFVFDGGRIVSGRVGSSIVDLSLPGTFSVQRRGDKYEDTRKTLMKFGLRQLPD"	"unreviewed"	"{'taxId': '296587', 'scientificName': 'Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709)', 'fullName': 'Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) (Picoplanktonic green alga)'}"