"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C1BKM9"	"{'domain_architectures': 2401, 'entries': 8, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'smart': 1, 'panther': 1, 'pirsf': 1, 'pfam': 1, 'prosite': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 2401}"	"['Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization']"	"TYB4"	"[{'identifier': 'GO:0003785', 'name': 'actin monomer binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0007015', 'name': 'actin filament organization', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"C1BKM9_OSMMO"	"c96314aa692f4b40c814b6411bf0116e09c235c6"	True	False	False	42	"Thymosin beta"	2	""	"MSDKPDLAEVTNFDKTKLKKTDTQEKNPLPSKETIEQEKAAS"	"unreviewed"	"{'taxId': '8014', 'scientificName': 'Osmerus mordax', 'fullName': 'Osmerus mordax (Rainbow smelt)'}"