General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "C0VHD2",
        "id": "CDND_ACIS2",
        "source_organism": {
            "taxId": "525244",
            "scientificName": "Acinetobacter sp. (strain ATCC 27244 / 9458)",
            "fullName": "Acinetobacter sp. (strain ATCC 27244 / 9458)"
        },
        "name": "Cyclic AMP-AMP-AMP synthase",
        "description": [
            "Cyclic nucleotide synthase (second messenger synthase) of a CBASS antivirus system (PubMed:32544385). CBASS (cyclic oligonucleotide-based antiphage signaling system) provides immunity against bacteriophage. The CD-NTase protein synthesizes cyclic nucleotides in response to infection; these serve as specific second messenger signals. The signals activate a diverse range of effectors, leading to bacterial cell death and thus abortive phage infection. A type II-C(AAAA) CBASS system (PubMed:32839535)",
            "Cyclic trinucleotide synthase that catalyzes the synthesis of 2',3',3'-cyclic AMP-AMP-AMP (2',3',3'-c-tri-AMP or 2'3'3'-cAAA) as the major product, as well as another cyclic AMP(4) 2'-5'-linked minor product that acts as a second messenger for cell signal transduction"
        ],
        "length": 343,
        "sequence": "MGSERIMTTQQQFLDLLSDIEPSTTTVNDCSSAHNTLRDALKVHNEFSKVHVHTFLSGSYKRNTAVRPTTIGGITQRPDVDIIALTNHTINDDPQIVLDAVHTALKDIGYTDLTVNRRSVNVKLKKVDMDVVPIISDGYGGYLIPDIHLEEWLVTNPPAHTEWTVEVNKNANGRFKPLVKLFKWWRRENLSDLKRPKGFILECLVAKHMNYYESNYEKLFVYLLETIRDSYGIYASLGIIPHLEDPGVAGNNVFSAVTADEFKTFFEKVEEQAAIARNALNETDDDKALALWRQVLGNRFPRSASHKSANSADMASSLIRSALGAGLTFPSTPVYPNKPGGFA",
        "proteome": null,
        "gene": "cdnD01",
        "go_terms": [
            {
                "identifier": "GO:0016779",
                "name": "nucleotidyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6b9451b27a1bdd74e6b6e69db8a760dcc0a0f900",
        "counters": {
            "domain_architectures": 2299,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 2299
        }
    }
}