"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"C0B6A9"	"{'domain_architectures': 36724, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'pirsf': 1, 'panther': 1, 'ncbifam': 1, 'hamap': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 36724}"	"['Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids']"	"maf"	"[{'identifier': 'GO:0047429', 'name': 'nucleoside triphosphate diphosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"C0B6A9_9FIRM"	"4e50f860811e8bd429a94ec3d863c201dce946d0"	True	False	False	200	"dTTP/UTP pyrophosphatase"	3	""	"MCSRTQKLTVVLASASPRRTELLEQGNIKHVVMPSHCEEVITSQVPSQVVEELSVQKAEDVYQQYETKNTGDFLVIGSDTVVAADGKILGKPKDKEEAYQMISMLQGKAHQVYTGVTLLIKKDGKKIRKTFHECSDVHVYPMSKEEIREYIATGEPMDKAGAYGIQGAFGVYICGIEGDYNTIVGLPLARVYQEMKKYIY"	"unreviewed"	"{'taxId': '470146', 'scientificName': 'Coprococcus comes ATCC 27758', 'fullName': 'Coprococcus comes ATCC 27758'}"
