"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B9SIS1"	"{'domain_architectures': 93161, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'profile': 1, 'panther': 1, 'pirsf': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 93161}"	"['Functions as a component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Arp2/3 complex plays a critical role in the control of cell morphogenesis via the modulation of cell polarity development', 'Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks']"	"RCOM_0540370"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0034314', 'name': 'Arp2/3 complex-mediated actin nucleation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005885', 'name': 'Arp2/3 protein complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0015629', 'name': 'actin cytoskeleton', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"B9SIS1_RICCO"	"35c3a2b802fd9ab75d4e0df5220beffd6dca46af"	True	False	False	386	"Actin-related protein 2/3 complex subunit"	3	"UP000008311"	"MAAISVHQFAQCITCHAWSPDHSMIALCPNNNEVHIYKSSPEDKWERVHVLQKHDQIVSGIDWSVRCNRIVTASHDRNSYVWNREGAEWVPTLVILRLNRAALCVQWSPKENKFAVGSGAKTVCICYYEQDNNWWVSKLIRKRHDSSVTSVAWHPNNILLATTSTDGKCRVFSTFIKGVDTRDSKAGSSSDSKFGEQIIQLDLSFSWAFGVKWSPSGNTLAYVGHNSMIYFVDDVGPSPLAQNVAYRDLPLRDVIFVSEKMVIGGGFDCNPMVFVADERGIWSFIRFLGERKSSLPGSKYGSQFSEAFGKFYGQSKIGGSNDAIDSTRSHGGIHDNCIKLMPDTAFVGTVAVLRLSGSKVVPEHCASALQYNIFEEVLDAGNMPVY"	"unreviewed"	"{'taxId': '3988', 'scientificName': 'Ricinus communis', 'fullName': 'Ricinus communis (Castor bean)'}"