"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B9MQG9"	"{'domain_architectures': 57558, 'entries': 14, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'cdd': 1, 'hamap': 1, 'ncbifam': 1, 'pirsf': 1, 'panther': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 57558}"	"['One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, probably blocks exit of the E-site tRNA']"	"rpsG"	"[{'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0015935', 'name': 'small ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"RS7_CALBD"	"b38a96b66a03eafcff49a4d98ca22b5cde0cd722"	True	False	False	157	"Small ribosomal subunit protein uS7"	3	""	"MPRKGPVKKREILPDPVYNDKVVAKLINKVMYDGKKSIAQKIVYGAFDIIREKTGKDPLEVLEAALNNVMPVLEVRPRRVGGATYQVPIEVAPDRRLSLGIRWLVEYARERKDKRTMKEKLAAEIMDAANNTGGAVKKKEDTHRMAEANRAFAHYRW"	"reviewed"	"{'taxId': '521460', 'scientificName': 'Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)', 'fullName': 'Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)'}"
