"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B9IIA7"	"{'domain_architectures': 5800, 'entries': 19, 'isoforms': 0, 'proteomes': 1, 'sets': 5, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 2, 'cdd': 2, 'pfam': 3, 'profile': 2, 'panther': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5800}"	"['E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. It probably triggers the ubiquitin-mediated degradation of different substrates. Mediates the proteasomal-dependent degradation of ATG6, a component of the autophagosome complex. Requires TRAF1A/MUSE14 and TRAF1B/MUSE13 to target ATG6 for ubiquitination and subsequent regulation of autophagosome assembly. Modulates directly the ubiquitination and proteasomal-dependent degradation of FREE1, a component of the ESCRT-I complex. Modulates directly the ubiquitination and proteasomal-dependent degradation of ELC/VPS23A, a component of the ESCRT-I complex']"	"POPTR_016G059700"	"[{'identifier': 'GO:0008270', 'name': 'zinc ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006511', 'name': 'ubiquitin-dependent protein catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0007275', 'name': 'multicellular organism development', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"B9IIA7_POPTR"	"3f468851f694fe28c25bcae276188b81757b837b"	True	False	False	304	"RING-type E3 ubiquitin transferase"	3	"UP000006729"	"MAPGGSAFKEVLELVAECDIATSKSENNIAPTKGTVILSGKHGVYSNNGVHELLECPVCTNLMYPPIHQCPNGHTLCSACKLRVHNCCPTCRYDLGNIRCLALEKVAESLELPCKYQSLGCLDVFPYYSKLKHEQHCRFRPYSCPYAGSECSVTGDIPALAAHLKDDHKVDMHDGCTFNHRYVKSNPHEVENATWMLTVFNCFGRQFCLHFEAFQLGMAPVYMAFLRFMGDDNEAKKFSYSLEVGGNGRKLVWQGIPRSIRDSHRKVRDSQDGLIIQRNLALYFSGGDRKELKLRVTGRVWKEE"	"unreviewed"	"{'taxId': '3694', 'scientificName': 'Populus trichocarpa', 'fullName': 'Populus trichocarpa (Western balsam poplar)'}"