"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B8J4W2"	"{'domain_architectures': 32373, 'entries': 16, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'profile': 1, 'ncbifam': 2, 'panther': 1, 'hamap': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 32373}"	"['The glycine cleavage system catalyzes the degradation of glycine. The H protein shuttles the methylamine group of glycine from the P protein to the T protein']"	"gcvH"	"[{'identifier': 'GO:0019464', 'name': 'glycine decarboxylation via glycine cleavage system', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005960', 'name': 'glycine cleavage complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"B8J4W2_DESDA"	"676356c2fef36c74096b9603921b62087f9f9212"	True	False	False	134	"Glycine cleavage system H protein"	3	""	"MKDLDQVELPENIRYTSEHVWLRMDGEAALVGISDFAQDQLGEIAFVDLPAEGAHFKAGEEFGTVESIKSVSSLYMPVSGTVRTVNSALEDAPTLVNVEPYTEGWMICITPDNPDDAAAMTDAAAYRALLADNA"	"unreviewed"	"{'taxId': '525146', 'scientificName': 'Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)', 'fullName': 'Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)'}"
