"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B8J2Y2"	"{'domain_architectures': 9361, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 9361}"	"['Responsible for the coupling of flagellin expression to flagellar assembly by preventing expression of the flagellin genes when a component of the middle class of proteins is defective. It negatively regulates flagellar genes by inhibiting the activity of FliA by directly binding to FliA']"	"Ddes_2005"	"[{'identifier': 'GO:0045892', 'name': 'negative regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B8J2Y2_DESDA"	"f1674cf6f70d6b376bb3587a0ee9057d80ec7fd1"	True	False	False	107	"Negative regulator of flagellin synthesis"	3	""	"MEIKNTPNSFFDPYATGLEKNAAARSDARARQRAGTAGEEAGQGDTVSVSQDALLMTEARRAAQSAPDVRSEKVETLRIQVANGTYKPDSRLIASSLVREEPGLFRI"	"unreviewed"	"{'taxId': '525146', 'scientificName': 'Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)', 'fullName': 'Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)'}"