"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B8H8Y9"	"{'domain_architectures': 25728, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'hamap': 1, 'pfam': 1, 'ncbifam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 25728}"	"['Specifically methylates the N7 position of guanine in position 518 of 16S rRNA']"	"rsmG"	"[{'identifier': 'GO:0008649', 'name': 'rRNA methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006364', 'name': 'rRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005737', 'name': 'cytoplasm', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RSMG_PSECP"	"dab470c3cc0611b3efe4c44bfc5a79eb65c34c07"	True	False	False	216	"Ribosomal RNA small subunit methyltransferase G"	3	"UP000002505"	"MVDITAAELRAAEKIFGDRLDLAKRYVEHLATSGTERGLIGPREIPRLWSRHVLNCAVIESEIPQGSRVADVGSGAGLPGLCLAIARPDLELTLIEPLERRVIWLQEVVDDLGLDNVTVMRSRAELAVGHVEADVVTARAVSALTNLAGLTIPLLGGTGEVIAIKGRSAGEEIEKAAKAIRKLGGVETSVLTVGDNLLEEPTTVVRIVVNKPQKKS"	"reviewed"	"{'taxId': '452863', 'scientificName': 'Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)', 'fullName': 'Pseudarthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / CIP 107037 / JCM 12360 / KCTC 9906 / NCIMB 13794 / A6)'}"
