"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B8DNJ4"	"{'domain_architectures': 26600, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'hamap': 1, 'panther': 1, 'pirsf': 1, 'pfam': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 26600}"	"[""Specifically methylates the uridine in position 2552 of 23S rRNA at the 2'-O position of the ribose in the fully assembled 50S ribosomal subunit""]"	"rlmE"	"[{'identifier': 'GO:0008168', 'name': 'methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0001510', 'name': 'RNA methylation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0032259', 'name': 'methylation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"RLME_NITV9"	"71a5d42e748b06cd2d42035318a449fe592a7c1a"	True	False	False	201	"Ribosomal RNA large subunit methyltransferase E"	3	""	"MKTYRDHYFLKAKQENYPARSIYKLKEIDNRFKLFRQGMKVLDLGAAPGSWSLGAAERVGPKGRVLACDLQTTDTQFPPNVTFMQEDVFNRSEAFEDALAAMGPFHVVISDMAPRTTGTRFTDQARSLELCIEALAVADHCLIKGGSFVVKIFMGPDVKQLLDALRARFETVKTFKPKSSRVESKETFYVCLGYRGDGQQD"	"reviewed"	"{'taxId': '883', 'scientificName': 'Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)', 'fullName': 'Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)'}"