"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B8DDU2"	"{'domain_architectures': 0, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'cdd': 1, 'pirsf': 1, 'ncbifam': 1, 'hamap': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1}"	"['Transcriptional factor involved in regulation of membrane lipid biosynthesis by repressing genes involved in fatty acid and phospholipid metabolism']"	"fapR"	"[{'identifier': 'GO:0003700', 'name': 'DNA-binding transcription factor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0045717', 'name': 'negative regulation of fatty acid biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0045892', 'name': 'negative regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"FAPR_LISMH"	""	True	False	False	189	"Transcription factor FapR"	3	""	"MKKYSKKDRQMKLQVAIEENPFITDEQLAEKFGVSVQTIRLDRVALSIPELRERIKHVASVTYADAVKSLPIDEVIGEIIDIQLSKSAISIFDVRSEHVFKRNKIARGHHLFAQANSLATAVIPNEIALTTQATVRFVRSVNEGERIIAKAKVRPATDNRAITIVDVKSYVGDEIVLKGKFEMYHATQK"	"reviewed"	"{'taxId': '552536', 'scientificName': 'Listeria monocytogenes serotype 4a (strain HCC23)', 'fullName': 'Listeria monocytogenes serotype 4a (strain HCC23)'}"