"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7ZQ67"	"{'domain_architectures': 39207, 'entries': 18, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 2, 'ssf': 1, 'cathgene3d': 1, 'pfam': 2, 'smart': 2, 'pirsf': 1, 'panther': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 39207}"	"['Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals']"	"ccnd2.L"	"[{'identifier': 'GO:0016538', 'name': 'cyclin-dependent protein serine/threonine kinase regulator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0044772', 'name': 'mitotic cell cycle phase transition', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"B7ZQ67_XENLA"	"fd1efc4a1ce5c8e2dc0db0172d8c97e704be840e"	True	False	False	291	"G1/S-specific cyclin-D2"	2	"UP000186698"	"MELLCCEGDTVRRAQPDPALLLDDRVLHNLLTVEERYLPQCSYFKCVQKDIQPFMRRMVATWMLEVCEEQRCEEEVFPMAMNYLDRFLAVIPTRKCHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPLPKDKLLLIRKHAQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLDVGETSLSGDSLTEHLAKITSTDVDCLKACQEQIESVLVSSLRQTRQQTQQRNSSKSVDELDQASTPTDVQDINL"	"unreviewed"	"{'taxId': '8355', 'scientificName': 'Xenopus laevis', 'fullName': 'Xenopus laevis (African clawed frog)'}"
