"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7UPF1"	"{'domain_architectures': 5154, 'entries': 18, 'isoforms': 0, 'proteomes': 1, 'sets': 3, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'pfam': 2, 'profile': 1, 'cdd': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 5154}"	"[""mRNA decapping enzyme that specifically removes the nicotinamide adenine dinucleotide (NAD) cap from a subset of mRNAs by hydrolyzing the diphosphate linkage to produce nicotinamide mononucleotide (NMN) and 5' monophosphate mRNA. The NAD-cap is present at the 5'-end of some mRNAs and stabilizes RNA against 5'-processing. Has preference for mRNAs with a 5'-end purine. Catalyzes the hydrolysis of a broad range of dinucleotide pyrophosphates""]"	"nudC"	"[{'identifier': 'GO:0016787', 'name': 'hydrolase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0046872', 'name': 'metal ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0000210', 'name': 'NAD+ diphosphatase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"NUDC_ECO27"	"3699a44c1f8bf9d98308f8700bb15e18a36a8aa4"	True	False	False	257	"NAD-capped RNA hydrolase NudC"	3	"UP000008205"	"MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLVQLQRRHDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFMAEYDSGEIVIDPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEYE"	"reviewed"	"{'taxId': '574521', 'scientificName': 'Escherichia coli O127:H6 (strain E2348/69 / EPEC)', 'fullName': 'Escherichia coli O127:H6 (strain E2348/69 / EPEC)'}"