"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7NU06"	"{'domain_architectures': 22630, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'ncbifam': 2, 'hamap': 1, 'pirsf': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 22630}"	"['Part of a membrane-bound complex that couples electron transfer with translocation of ions across the membrane. Required to maintain the reduced state of SoxR']"	"rsxA"	"[{'identifier': 'GO:0022900', 'name': 'electron transport chain', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RSXA_ECO7I"	"ab97e895e3c90b2580dc69b86b41d64f6f9b8e90"	True	False	False	193	"Ion-translocating oxidoreductase complex subunit A"	3	""	"MTDYLLLFVGTVLVNNFVLVKFLGLCPFMGVSKKLETAMGMGLATTFVMTLASICAWLIDTWILIPLNLIYLRTLAFILVIAVVVQFTEMVVRKTSPVLYRLLGIFLPLITTNCAVLGVALLNINLGHNFLQSALYGFSAAVGFSLVMVLFAAIRERLAVADVPAPFRGNAIALITAGLMSLAFMGFSGLVKL"	"reviewed"	"{'taxId': '585057', 'scientificName': 'Escherichia coli O7:K1 (strain IAI39 / ExPEC)', 'fullName': 'Escherichia coli O7:K1 (strain IAI39 / ExPEC)'}"