"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7N147"	"{'domain_architectures': 3886, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 2, 'cathgene3d': 2, 'pfam': 2, 'hamap': 1, 'ncbifam': 2, 'panther': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3886}"	"['Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins']"	"nfuA"	"[{'identifier': 'GO:0051539', 'name': '4 iron, 4 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016226', 'name': 'iron-sulfur cluster assembly', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0051604', 'name': 'protein maturation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005506', 'name': 'iron ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"NFUA_ECO81"	"3a5a13e41f82d8bd6b0d9d64463c24bb48c46758"	True	False	False	191	"Fe/S biogenesis protein NfuA"	3	""	"MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDLLTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQINPQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDLTEHQRGEHSYY"	"reviewed"	"{'taxId': '585397', 'scientificName': 'Escherichia coli O81 (strain ED1a)', 'fullName': 'Escherichia coli O81 (strain ED1a)'}"