"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"B7MPH5"	"{'domain_architectures': 27024, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 27024}"	"[""Single strand-specific metallo-endoribonuclease involved in late-stage 70S ribosome quality control and in maturation of the 3' terminus of the 16S rRNA""]"	"ybeY"	"[{'identifier': 'GO:0004222', 'name': 'metalloendopeptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006364', 'name': 'rRNA processing', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"YBEY_ECO81"	"6ce7ffab98862a99814a555b2e3be9e9cdf93050"	True	False	False	155	"Endoribonuclease YbeY"	3	""	"MSQVILDLQLACEDNSGLPEESQFQTWLNAVIPQFQEESEVTIRVVDTAESHCLNLTYRGKDKPTNVLSFPFEVPPGMEMSLLGDLIICRQVVEKEAQEQGKPLEAHWAHMVVHGSLHLLGYDHIEDDEAEEMEAIETEIMLALGYEDPYIAEKE"	"reviewed"	"{'taxId': '585397', 'scientificName': 'Escherichia coli O81 (strain ED1a)', 'fullName': 'Escherichia coli O81 (strain ED1a)'}"