GET /api/protein/UniProt/B7MIG3/?format=api&page_size=20
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "B7MIG3",
        "id": "B7MIG3_ECO45",
        "source_organism": {
            "taxId": "585035",
            "scientificName": "Escherichia coli O45:K1 (strain S88 / ExPEC)",
            "fullName": "Escherichia coli O45:K1 (strain S88 / ExPEC)"
        },
        "name": "Ferrous iron permease EfeU",
        "description": [
            "Uptake of Fe(2+) ions across the membrane"
        ],
        "length": 279,
        "sequence": "MGGMFVPFLIMLREGLEAALIVSLIASYLKRTQRGRWIGVMWIGVLLAAALCLGLGIFINETTGEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALVMMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNLGAFFKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQEAPSVSEVAVWFIYLIPALVAFVLPPRAGATASRSV",
        "proteome": "UP000000747",
        "gene": "efeU",
        "go_terms": [
            {
                "identifier": "GO:0005381",
                "name": "iron ion transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0034755",
                "name": "iron ion transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005886",
                "name": "plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0033573",
                "name": "high-affinity iron permease complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a6034fa5a24fd9730497af4904df13ee9eb30a43",
        "counters": {
            "domain_architectures": 11983,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "ncbifam": 2,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11983
        }
    }
}