HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "B7MIG3",
"id": "B7MIG3_ECO45",
"source_organism": {
"taxId": "585035",
"scientificName": "Escherichia coli O45:K1 (strain S88 / ExPEC)",
"fullName": "Escherichia coli O45:K1 (strain S88 / ExPEC)"
},
"name": "Ferrous iron permease EfeU",
"description": [
"Uptake of Fe(2+) ions across the membrane"
],
"length": 279,
"sequence": "MGGMFVPFLIMLREGLEAALIVSLIASYLKRTQRGRWIGVMWIGVLLAAALCLGLGIFINETTGEFPQKEQELFEGIVAVIAVVILTWMVFWMRKVSRNVKVQLEQAVDSALQRGNHHGWALVMMVFFAVAREGLESVFFLLAAFQQDVGIWPPLGAMLGLATAVVLGFLLYWGGIRLNLGAFFKWTSLFILFVAAGLAAGAIRAFHEAGLWNHFQEIAFDMSAVLSTHSLFGTLMEGIFGYQEAPSVSEVAVWFIYLIPALVAFVLPPRAGATASRSV",
"proteome": "UP000000747",
"gene": "efeU",
"go_terms": [
{
"identifier": "GO:0005381",
"name": "iron ion transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0034755",
"name": "iron ion transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005886",
"name": "plasma membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0033573",
"name": "high-affinity iron permease complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a6034fa5a24fd9730497af4904df13ee9eb30a43",
"counters": {
"domain_architectures": 11983,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"ncbifam": 2,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 11983
}
}
}